Protein network and pathway analysis in a pharmacogenetic study of cyclosporine treatment response in Greek patients with psoriasis
Psoriasis is a chronic, inflammatory skin disease that affects 2-3% of the world's population. Due to its multifactorial nature, with the interaction of genetic and environmental factors contributing to its pathogenesis, multiple therapeutic approaches have been developed. Cyclosporine is an im...
| Κύριος συγγραφέας: | |
|---|---|
| Άλλοι συγγραφείς: | |
| Γλώσσα: | Greek |
| Έκδοση: |
2023
|
| Θέματα: | |
| Διαθέσιμο Online: | https://hdl.handle.net/10889/24486 |
| id |
nemertes-10889-24486 |
|---|---|
| record_format |
dspace |
| institution |
UPatras |
| collection |
Nemertes |
| language |
Greek |
| topic |
Pharmacogenetics Cyclosporine Psoriasis Φαρμακογενετική Κυκλοσπορίνη Ψωρίαση |
| spellingShingle |
Pharmacogenetics Cyclosporine Psoriasis Φαρμακογενετική Κυκλοσπορίνη Ψωρίαση Αντωνάτος, Χαράλαμπος Protein network and pathway analysis in a pharmacogenetic study of cyclosporine treatment response in Greek patients with psoriasis |
| description |
Psoriasis is a chronic, inflammatory skin disease that affects 2-3% of the world's population. Due to its multifactorial nature, with the interaction of genetic and environmental factors contributing to its pathogenesis, multiple therapeutic approaches have been developed. Cyclosporine is an immunosuppressive drug that creates a complex with cyclophilin, aiming at the inactivation of the Nuclear Factor of T cells. Despite its high specificity and importance in the immune cascade of Psoriasis, the clinical heterogeneity displayed by the treatment response of patients with Psoriasis, as well as the multiple adverse effects, raises the need for the investigation of pharmacogenetic biomarkers. The aim of this dissertation is the pharmacogenetic analysis of Greek patients with psoriasis treated with cyclosporine, based on the reconstruction of the protein interaction network of the molecules involved in its mechanism of action.
The protein interaction network was reconstructed using the PICKLE metabase. Through this, 27 polymorphisms in 22 genes encoding key proteins implicated in the drug's mechanism of action were selected. Forward, reverse and extension primers were designed through the iPLEX®GOLD platform and utilized for the genotyping of 200 Greek patients through the MassARRAY® system (Agena Bioscences). In addition to individual polymorphism analysis, haplotype analysis was performed in the additive inheritance model, with a frequency threshold of 10%.
The common alleles of 2 polymorphisms, namely CALM1 rs12885713 (P=0.0005) and MALT1 rs2874116 (P=2.3×10-5), were found to be statistically significantly associated with patients' positive response to cyclosporine. Haplotype analysis further enhanced the predictive significance rs12885713 as a pharmacogenetic biomarkers in psoriasis (P=0.01).
These findings have the potential not only of improving the treatment with cyclosporine prognosis but also of establishing the framework for the investigation of complex phenotypes in the context of pharmacogenetics. |
| author2 |
Antonatos, Charalampos |
| author_facet |
Antonatos, Charalampos Αντωνάτος, Χαράλαμπος |
| author |
Αντωνάτος, Χαράλαμπος |
| author_sort |
Αντωνάτος, Χαράλαμπος |
| title |
Protein network and pathway analysis in a pharmacogenetic study of cyclosporine treatment response in Greek patients with psoriasis |
| title_short |
Protein network and pathway analysis in a pharmacogenetic study of cyclosporine treatment response in Greek patients with psoriasis |
| title_full |
Protein network and pathway analysis in a pharmacogenetic study of cyclosporine treatment response in Greek patients with psoriasis |
| title_fullStr |
Protein network and pathway analysis in a pharmacogenetic study of cyclosporine treatment response in Greek patients with psoriasis |
| title_full_unstemmed |
Protein network and pathway analysis in a pharmacogenetic study of cyclosporine treatment response in Greek patients with psoriasis |
| title_sort |
protein network and pathway analysis in a pharmacogenetic study of cyclosporine treatment response in greek patients with psoriasis |
| publishDate |
2023 |
| url |
https://hdl.handle.net/10889/24486 |
| work_keys_str_mv |
AT antōnatoscharalampos proteinnetworkandpathwayanalysisinapharmacogeneticstudyofcyclosporinetreatmentresponseingreekpatientswithpsoriasis AT antōnatoscharalampos pharmakogenetikēmeletēpolymorphismōnstomonopatidrasēstēskyklosporinēskaiantapokrisēssetherapeiamekyklosporinēseastheneismepsōriasēstonellēnikoplēthysmo |
| _version_ |
1771297241143705600 |
| spelling |
nemertes-10889-244862023-02-21T04:36:25Z Protein network and pathway analysis in a pharmacogenetic study of cyclosporine treatment response in Greek patients with psoriasis Φαρμακογενετική μελέτη πολυμορφισμών στο μονοπάτι δράσης της κυκλοσπορίνης και ανταπόκρισης σε θεραπεία με κυκλοσπορίνη σε ασθενείς με ψωρίαση στον ελληνικό πληθυσμό Αντωνάτος, Χαράλαμπος Antonatos, Charalampos Pharmacogenetics Cyclosporine Psoriasis Φαρμακογενετική Κυκλοσπορίνη Ψωρίαση Psoriasis is a chronic, inflammatory skin disease that affects 2-3% of the world's population. Due to its multifactorial nature, with the interaction of genetic and environmental factors contributing to its pathogenesis, multiple therapeutic approaches have been developed. Cyclosporine is an immunosuppressive drug that creates a complex with cyclophilin, aiming at the inactivation of the Nuclear Factor of T cells. Despite its high specificity and importance in the immune cascade of Psoriasis, the clinical heterogeneity displayed by the treatment response of patients with Psoriasis, as well as the multiple adverse effects, raises the need for the investigation of pharmacogenetic biomarkers. The aim of this dissertation is the pharmacogenetic analysis of Greek patients with psoriasis treated with cyclosporine, based on the reconstruction of the protein interaction network of the molecules involved in its mechanism of action. The protein interaction network was reconstructed using the PICKLE metabase. Through this, 27 polymorphisms in 22 genes encoding key proteins implicated in the drug's mechanism of action were selected. Forward, reverse and extension primers were designed through the iPLEX®GOLD platform and utilized for the genotyping of 200 Greek patients through the MassARRAY® system (Agena Bioscences). In addition to individual polymorphism analysis, haplotype analysis was performed in the additive inheritance model, with a frequency threshold of 10%. The common alleles of 2 polymorphisms, namely CALM1 rs12885713 (P=0.0005) and MALT1 rs2874116 (P=2.3×10-5), were found to be statistically significantly associated with patients' positive response to cyclosporine. Haplotype analysis further enhanced the predictive significance rs12885713 as a pharmacogenetic biomarkers in psoriasis (P=0.01). These findings have the potential not only of improving the treatment with cyclosporine prognosis but also of establishing the framework for the investigation of complex phenotypes in the context of pharmacogenetics. Η ψωρίαση είναι μια χρόνια, φλεγμονώδης δερματοπάθεια που επηρεάζει το 2-3% του παγκόσμιου πληθυσμού. Λόγω της πολυπαραγοντικής της φύσης, με την αλληλεπίδραση γενετικών και περιβαλλοντικών παραγόντων να οδηγούν στην παθογένεσή της, έχουν αναπτυχθεί πολλαπλές θεραπευτικές προσσεγγίσεις για την αντιμετώπιση των σοβαρών της συμπτωμάτων. Η κυκλοσπορίνη είναι ένα ανοσοκατασταλτικό φάρμακο που στοχεύει την απενεργοποίηση του Πυρηνικού Παράγοντα των Τ λεμφοκυττάρων μέσω δημιουργίας συμπλόκου με την κυκλοφιλίνη. Παρά την υψηλή της ειδίκευση και σημασία στον ανοσολογικό καταρράκτη της νόσου, η υψηλή κλινική ετερογένεια που εμφανίζει η ανταπόκριση στη θεραπεία των ασθενών με κυκλοσπορίνη, σε συνδυασμό με τις πολλαπλές παρενέργειες, χρήζει τη διερεύνηση φαρμακογενετικών βιοδεικτών. Σκοπός της παρούσας διπλωματικής εργασίας είναι η φαρμακογενετική ανάλυση Ελλήνων ασθενών με ψωρίαση σε θεραπεία με κυκλοσπορίνη, βασιζόμενοι στην ανακατασκευή του πρωτεϊνικού δικτύου αλληλεπιδράσεων των μορίων που συμμετέχουν στο μονοπάτι δράσης της. Το πρωτεϊνικό δίκτυο αλληλεπιδράσεων ανακατασκευάστηκε μέσω της μετα-βάσης PICKLE. Μέσω αυτού, επιλέχθηκαν 27 πολυμορφισμοί σε 22 γονίδια που κωδικοποιούν κύριες πρωτεΐνες στο μονοπάτι δράσης του φαρμάκου. Forward, reverse και extension εκκινητές σχεδιάστηκαν μέσω της iPLEX®GOLD πλατφόρμας και χρησιμοποιήθηκαν για τη γονοτύπηση 200 Ελλήνων ασθενών μέσω του συστήματος MassARRAY® (Agena Bioscences). Εκτός από τη μεμονωμένη ανάλυση πολυμορφισμών, πραγματοποιήθηκε ανάλυση απλοτύπων στο προσθετικό μοντέλο κληρονόμησης, με όριο συχνότητας το 10%. Τα κοινά αλληλόμορφα 2 πολυμορφισμών, και συγκεκριμένα των CALM1 rs12885713 (P=0.0005) και MALT1 rs2874116 (P=2.3×10-5), βρέθηκαν να σχετίζονται στατιστικά σημαντικά με τη θετική ανταπόκριση των ασθενών σε κυκλοσπορίνη. Η ανάλυση απλοτύπων ενίσχυσε ακόμα περισσότερο την προβλεπτική σημασία του rs12885713 ως φαρμακογενετικοί βιοδείκτες στην ψωρίαση (P=0.01). Τα ευρήματα αυτά έχουν την προοπτική όχι μόνο να βελτιώσουν την πρόγνωση της ανταπόκρισης στη θεραπεία με κυκλοσπορίνη αλλά και ταυτόχρονα να αποτελέσουν τη μεθοδολογική βάση για τη διερεύνηση πολύπλοκων φαινοτύπων στο πλαίσιο της φαρμακογενετικής. 2023-02-20T09:38:10Z 2023-02-20T09:38:10Z 2023-02-20 https://hdl.handle.net/10889/24486 el Attribution-NonCommercial-NoDerivs 3.0 United States http://creativecommons.org/licenses/by-nc-nd/3.0/us/ application/pdf |